Quick search:







Description Entry page for GPCR - 'MELANIN-CONCENTRATING RECEPTORS_MCH1_Homo sapiens'
ClassCLASS A
FamilyMELANIN-CONCENTRATING RECEPTORS
Sub-FamilyMCH1
Cross References:
References
UniProtQ99705 | B2RBX6 | Q5R3J1 | Q96S47 | Q9BV08
EMBLAB063174 | AF490537 | CR456497 | BT006725 | AY562945 | AK314857 | Z86090 | CH471095 | BC001736 | BC021146 | U71092
InterProIPR000276 | IPR017452 | IPR004047 | IPR008361
PRODOM
GENEID2847
MIM601751
PRINTSPR00237 | PR01507 | PR01783
PFAMPF00001
Other GPCR resourcesGPCRDB | GPCR-OKB | GLIDA
Details:
Details
NameMELANIN-CONCENTRATING RECEPTORS_MCH1_Homo sapiens
DescriptionRecName: Full=Melanin-concentrating hormone receptor 1; Short=MCH receptor 1; Short=MCHR-1; Short=MCH-R1;AltName: Full=MCH-1R; Short=MCH1R; Short=MCHR;AltName: Full=G-protein coupled receptor 24;AltName: Full=Somatostatin receptor-like protein;AltName: Full=SLC-1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneMCHR1 | GPR24,SLC
FunctionReceptor for melanin-concentrating hormone, coupled tos both G proteins that inhibit adenylyl cyclase and G proteins thats activate phosphoinositide hydrolysis
Fragment0
Sequence
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
Interacting with G-proteins:
G-proteins
NoNameCouplingPubMed
1Galpha-i3_Homo sapiensGi/o10559938
2Galpha-i1_Homo sapiensGi/o10559938
3Galpha-14_Homo sapiensGq/1110559938
4Galpha-11_Homo sapiensGq/1110559938
5Galpha-q_Homo sapiensGq/1110559938
6Galpha-i2_Homo sapiensGi/o10559938
7Galpha-o_Homo sapiensGi/o10559938
8Galpha-z_Homo sapiensGi/o10559938
9Galpha-15_Homo sapiensGq/1110559938
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level