| Help for this page | |
| Entry #1 of 1 |
| Protein Name |
AgamCPR1 | cuticleDB ID |
639 | ||||
| References | |||||||
| Entrez accession number (ac): - | |||||||
| Entrez "GenInfo Identifier" (gi): - | |||||||
| UniProt accession number:- | |||||||
| InterPro: | |||||||
| Pfam: | |||||||
| FlyBase: - | |||||||
| Ensembl: - | |||||||
| Taxonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles. | ||||||
| Species: Anopheles gambiae | |||||||
| Expression Details | |||||||
| Developmental stage: - | |||||||
| Tissue specificity: - | |||||||
| Reference: - | |||||||
| Sequence |
|||||||
10 20 30 40 50 60
| | | | | |
MAFKFVAFAALIAVARAGLIASPAVSYAAAPAVVAAAPVAKVAYAAAPAVVAAPVAKVAY
70 80 90 100 110 120
| | | | | |
AAQPEEYDANPHYSFSYGISDALTGDSKSQQESRSGDVVQGSYSVVDPDGTKRTVEYTAD
130 140 150 160 170 180
| | | | | |
PHNGFNAVVHREPLAAKTIVAAAPVATKTIVAQPAVAYAAPVAKTISYAAPLATKTVVAS
190 200 210 220 230 240
| | | | | |
PAISYAAPVAKLATPVAYTAALHH
| |||||||
| Method: Conceptual translation | Length: 204 | Source: Ensembl Submitted Annotations | |||||
| Patterns | |||||||
| Pattern: | Begin: | Finish: | |||||
| RR-2 | 65 | 133 | |||||
| PF00379 | 66 | 133 | |||||
| Designed for viewing with Internet Explorer 4 or above, Netscape 6 or above. | |||
|
contact biodb for comments, corrections and data (sequence) submission. | |||
|
|
University of Athens Faculty of Biology Dept. of Cell Biology and Biophysics |
Biophysics & Bioinformatics Laboratory |